Protein coding transcript 5370

• Transcript: Ll_transcript_444035
• CDS coordinates: 502-1422 (+)
• Peptide sequence: MNMNNSTPSYHSFLFQFHSSLAQFSQSLFPSLVIELFSLCLVMLSTISLLSSQLCTFTIILKDHGIALQATILFCFNPASIFYSSIYSESLYSLLSFGGMYYFASGGSNLSVLFLALSGCARSNGVLNAGYLCFQTMHQAYDAMFQKKRVILALQVVIAGAIRSAFIFAPFIAFQAYGYYNMCVGRSPVELRPWCKARVPLLYNYIQSHYWDVGFLRYFQLKQLPNFLLATPILSLALCSVVHYAKSRPQIFFSLGFQTSTEEKSCGVVFLSDDLSRSKIDGTVEKSSVKVEGIIILKQITLFCNC*
• ORF Type: complete

Annotations of Ll_transcript_444035

• Blastp: GPI mannosyltransferase 2 from Homo with 35.45% of identity
• Blastx: GPI mannosyltransferase 2 from Rattus with 31.51% of identity
• Eggnog: Phosphatidylinositol glycan anchor biosynthesis class V(COG5542)
• Kegg: Link to kegg annotations (55650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445861.1)
• Pfam: Mannosyltransferase (PIG-V) (PF04188.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;