Protein coding transcript 53712

• Transcript: Ll_transcript_303228
• CDS coordinates: 852-1715 (+)
• Peptide sequence: MIWLSQIHNFGSINLKGIQAENRRNIVPPSSRSSLNYVALRFSYYNSDTNDPGFQVKASSCRYMVVYQYGSAVLFNIEDHEVDHYLELVKRHASVLLPEMTKDDYTIKEKPLLVEDMEGGPDYIVLKSLDTDGIRIIGSVLGQSIALDYFVSQVDRLVEEFAGINRGMEKTGTFTMDKKKLLQLVGKANSHLADVILKVGLFERSEIAWRDAKYAQIYEYLREEYEVAQRFGNLDFKLKFVEHNIHFLQEVLQNRKSDFLEWCIIGLLAIENVISLYEILKESNTIS*
• ORF Type: complete

Annotations of Ll_transcript_303228

• Blastp: Sporulation protein RMD1 from Saccharomyces with 21.83% of identity
• Blastx: Sporulation protein RMD1 from Saccharomyces with 21.83% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YDL001W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459305.1)
• Pfam: Uncharacterised ACR, YagE family COG1723 (PF02582.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;