Transcript | Ll_transcript_303194 |
---|---|
CDS coordinates | 105-887 (+) |
Peptide sequence | MSGYPNQPPSYGYGAPPPPQTYGAPPPSQSYGAPPPSQSYGAPPPSAQPYSASSYGGPPPPSAPYASSPYSSSSGGPTKPPKDQSYSYGAGGGSYPPAPAYASPFAALVPSAFPPGTDPNVIACFQMADADGSGLIDDKEMQRALSSYNQSFSLRTVHLLMYHFTNTNINKIGPKEFTSLFYSLQNWRGIFERFDKDRSGKIDSTELRDALLSLGYAVSPLVLDLLVSKFDKTGGKSRAIEYDNFIEYGFRTNFFFFYCI* |
ORF Type | complete |
Blastp | Probable calcium-binding protein CML49 from Arabidopsis with 59.77% of identity |
---|---|
Blastx | Probable calcium-binding protein CML49 from Arabidopsis with 81.12% of identity |
Eggnog | grancalcin, EF-hand calcium binding protein(ENOG410YKQK) |
Kegg | Link to kegg annotations (AT3G10300) |
CantataDB | Link to cantataDB annotations (CNT0002570) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442952.1) |
Pfam | EF hand (PF13202.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer