Protein coding transcript 53790

• Transcript: Ll_transcript_303421
• CDS coordinates: 327-644 (+)
• Peptide sequence: MTSDGATSAMAASNRRKPSWRERENNRRRERRRRAIAAKIFSGLRAQGNYNLPKHCDNNEVLKALCAEAGWTVEPDGTTYRKVSIYLFLRGSPFSHFALSFLLFD*
• ORF Type: complete

Annotations of Ll_transcript_303421

• Blastp: Protein BRASSINAZOLE-RESISTANT 2 from Arabidopsis with 81.82% of identity
• Blastx: Protein BRASSINAZOLE-RESISTANT 2 from Arabidopsis with 81.82% of identity
• Eggnog: BES1 BZR1 homolog protein(ENOG410YC62)
• Kegg: Link to kegg annotations (AT1G19350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438006.1)
• Pfam: BES1/BZR1 plant transcription factor, N-terminal (PF05687.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;