Protein coding transcript 538

• Transcript: Ll_transcript_523691
• CDS coordinates: 3-335 (+)
• Peptide sequence: KIMDSEEISIWRAMIKTPASIALIIYTFVCVWFVGGLAVFHTYLISKNKTTYENFKNQFDRQANPYDRGIIENIKQVFCTSIPPSKNKFRSKIPIPKEPSDSSQSRTFHPL
• ORF Type: internal

Annotations of Ll_transcript_523691

• Blastp: Probable protein S-acyltransferase 5 from Arabidopsis with 59% of identity
• Blastx: Probable protein S-acyltransferase 5 from Arabidopsis with 59% of identity
• Eggnog: Zinc finger, DHHC-type containing(COG5273)
• Kegg: Link to kegg annotations (AT3G48760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462841.1)
• Pfam: DHHC palmitoyltransferase (PF01529.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;