Transcript | Ll_transcript_302587 |
---|---|
CDS coordinates | 287-697 (+) |
Peptide sequence | MNIFRLAGDMTHLFSVLVLLLKIHTIKSCAGISLKTQELYALVFASRYLDIFTNYISLYNTSMKLIFLGSSFSIVWYIRYHKIVRRTYDKEHDTFRHYILILPCLLLALVFHEKLTFREVSMQPLLLIVCNCCLTI* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | ER lumen protein-retaining receptor from Petunia with 88.54% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0001350) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450093.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer