Transcript | Ll_transcript_302588 |
---|---|
CDS coordinates | 143-790 (+) |
Peptide sequence | MNIFRLSGDMTHLASVLVLLLKIHTIKSCAGVSLKTQELYALVFASRYLDIFTHYISVYNTTMKLIFLGSSFSIVWYMRYHKIVRRTYNKDQDTFRHYILILPCLLLALVINERFTFREVMWAFSLYLEAVAILPQLVLLQRTRNIDNLTGQYVFLLGAYRALYILNWIYRYFTEPHFIHWITWISGLVQTLLYADFFYYYFQSWKNNQKLHLPA* |
ORF Type | complete |
Blastp | ER lumen protein-retaining receptor B from Arabidopsis with 83.72% of identity |
---|---|
Blastx | ER lumen protein-retaining receptor from Petunia with 87.44% of identity |
Eggnog | Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi (By similarity)(COG5196) |
Kegg | Link to kegg annotations (AT3G25040) |
CantataDB | Link to cantataDB annotations (CNT0001350) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431799.1) |
Pfam | ER lumen protein retaining receptor (PF00810.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer