Protein coding transcript 53843

• Transcript: Ll_transcript_302579
• CDS coordinates: 156-803 (+)
• Peptide sequence: MNIFRLSGDITHLASVLVLLLKIHTIKSCAGISLKTQELYALVFASRYLDIFTNYISLYNTTMKLIFLGSSFSIVWYMRYQKIVRRTYDKDQDTFRHYILILPCLLLALVINERFTFREVMWAFSLYLEAVAILPQLVLLQRTRNIDNLTGQYVFLLGAYRALYILNWIYRYFTEPHFIHWITWISGLVQTLLYADFFYYYIQSWKNNQKLHLPA*
• ORF Type: complete

Annotations of Ll_transcript_302579

• Blastp: ER lumen protein-retaining receptor B from Arabidopsis with 82.79% of identity
• Blastx: ER lumen protein-retaining receptor from Petunia with 86.51% of identity
• Eggnog: Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi (By similarity)(COG5196)
• Kegg: Link to kegg annotations (AT3G25040)
• CantataDB: Link to cantataDB annotations (CNT0001350)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461706.1)
• Pfam: ER lumen protein retaining receptor (PF00810.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;