Protein coding transcript 53852

• Transcript: Ll_transcript_303026
• CDS coordinates: 295-819 (+)
• Peptide sequence: MLKFPTGFAASADRTVKFWDLETFELIGSSRREVTGTQSIAFHPDGRTLFTGHENGLKVYSWEPVICHDTVDMGWTKLGDLCIHDGKLLGCSHFRNSVGVWVADISLIAPYADASDPKKKSEDTEQKLGLHGSKLNKVEDDVGPTSGLHSMSPDESKEIKNIYIDCKPLTLSIP*
• ORF Type: complete

Annotations of Ll_transcript_303026

• Blastp: Katanin p80 WD40 repeat-containing subunit B1 homolog from Arabidopsis with 57.43% of identity
• Blastx: Katanin p80 WD40 repeat-containing subunit B1 homolog from Arabidopsis with 58% of identity
• Eggnog: Katanin p80 (WD repeat containing) subunit B 1(ENOG410XQAC)
• Kegg: Link to kegg annotations (AT5G23430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426191.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;