Transcript | Ll_transcript_303014 |
---|---|
CDS coordinates | 415-723 (+) |
Peptide sequence | MGWTTLGDLCIHDGKLLGCSYFRNSVGVWVADISLIEPYADGFDPKKKSEGTEQKLSLHGSELDKVEVDVGPTSGFRNMSPDESKEIKNIYIDCKPPTLCFH* |
ORF Type | complete |
Blastp | Katanin p80 WD40 repeat-containing subunit B1 homolog from Arabidopsis with 45.16% of identity |
---|---|
Blastx | Katanin p80 WD40 repeat-containing subunit B1 homolog from Arabidopsis with 49.49% of identity |
Eggnog | Katanin p80 (WD repeat containing) subunit B 1(ENOG410XQAC) |
Kegg | Link to kegg annotations (AT5G23430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418885.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer