Protein coding transcript 53870

• Transcript: Ll_transcript_302381
• CDS coordinates: 1-930 (+)
• Peptide sequence: LIAVGCFVVCVICILFSNVGGPPLQVQVIQQINHDGEVNRARYMPQNPFIIATKTVSAEVYVFDYSKHPSKPPLDGACNPDLRLKGHNTEGYGLSWSNFKPGHLLSGSDDAQICLWDINSNGKNKSLEATQIFKVHEGVVEDVAWHLRHEYLFGSVGDDQYLLIWDLRSPSASKPVQSVVAHQSEVNCLAFNPFNEWIIATGSTDKTVKLFDLRKISAPLHTFDCHKEEVFQVGWNPKNETILASCCLGRRLMVWDLSRIDEEQPPEDAEDGPPELLFIHGGHTSKISDFSWNPCEDWVVASVAEDNILQ
• ORF Type: internal

Annotations of Ll_transcript_302381

• Blastp: WD-40 repeat-containing protein MSI1 from Lycopersicon with 89.15% of identity
• Blastx: WD-40 repeat-containing protein MSI1 from Lycopersicon with 89.15% of identity
• Eggnog: retinoblastoma binding protein(ENOG410XNU9)
• Kegg: Link to kegg annotations (543534)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433779.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;