Protein coding transcript 53961

• Transcript: Ll_transcript_438762
• CDS coordinates: 194-583 (+)
• Peptide sequence: MVEQVNPRAKVSVKLVAEAGIGTIASGVAKGNADIIQISGHDGGTGASPISSIKHAGGPWELGLTESHQTLIENGLRERVILRVDGGFKSGVDVMMAAIMGADEYGFGSMAMIATGCVMARICHTNNCPV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_438762

• Blastp: Ferredoxin-dependent glutamate synthase 1, chloroplastic/mitochondrial from Arabidopsis with 91.47% of identity
• Blastx: Ferredoxin-dependent glutamate synthase, chloroplastic from Oryza sativa with 88.37% of identity
• Eggnog: glutamate synthase(COG0067)
• Kegg: Link to kegg annotations (AT5G04140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017418246.1)
• Pfam: Conserved region in glutamate synthase (PF01645.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;