Protein coding transcript 53969

• Transcript: Ll_transcript_438755
• CDS coordinates: 332-796 (+)
• Peptide sequence: MSLGAISRETHEAIAIAMNRLGGKSNSGEGGEDPIRWKPLSDVVDGYSPTLPHLKGLQNGDTATSAIKQVASGRFGVTPTFLANADQIEIKIAQGAKPGEGGQLPGKKVSMYIARLRNSKPGVPLISPPPHHDIYSIEDLAQLIFDLHQVNPRAK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_438755

• Blastp: Ferredoxin-dependent glutamate synthase, chloroplastic from Zea with 94.84% of identity
• Blastx: Ferredoxin-dependent glutamate synthase, chloroplastic from Spinacia with 91.23% of identity
• Eggnog: glutamate synthase(COG0067)
• Kegg: Link to kegg annotations (542710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437056.1)
• Pfam: Conserved region in glutamate synthase (PF01645.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;