Protein coding transcript 53993

• Transcript: Ll_transcript_439461
• CDS coordinates: 1058-1453 (+)
• Peptide sequence: MTWCQQPAPKFWGTSIEAQVHGKRQLKLLNHGETYEMNCPHLLIRILPVPRVNWIGNVNIRCLETGLTADLLYTSSHSFLGIGGNHRLVKGKILDSSSSKVLYEVDGYWDRTVTVKDTNSGEIRVIYNAKEV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_439461

• Blastp: Oxysterol-binding protein-related protein 4B from Arabidopsis with 52.63% of identity
• Blastx: Oxysterol-binding protein-related protein 4B from Arabidopsis with 56.85% of identity
• Eggnog: Oxysterol-binding protein(ENOG410XRW6)
• Kegg: Link to kegg annotations (AT4G25850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442483.1)
• Pfam: Oxysterol-binding protein (PF01237.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;