Protein coding transcript 54000

• Transcript: Ll_transcript_439455
• CDS coordinates: 160-609 (+)
• Peptide sequence: MVKKEEKKVILTKPLSLEGESNSDTSYTTPNLLQRVLSLFKNVRPGSDLTRFELPPQFNFPKSQLQCHGESVYCTGLDVLSMCNTGQNPQERFISVVAWCISTTRPATFGVAPFNPILGETHHVSKGNLNVLLEQVHGLKVIKLCGFLS*
• ORF Type: complete

Annotations of Ll_transcript_439455

• Blastp: Oxysterol-binding protein-related protein 4C from Arabidopsis with 59.09% of identity
• Blastx: Oxysterol-binding protein-related protein 4C from Arabidopsis with 59.38% of identity
• Eggnog: Oxysterol-binding protein(ENOG410XRW6)
• Kegg: Link to kegg annotations (AT5G57240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416147.1)
• Pfam: Oxysterol-binding protein (PF01237.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;