Protein coding transcript 54016

• Transcript: Ll_transcript_438845
• CDS coordinates: 326-1105 (+)
• Peptide sequence: MSRTLRLCIAVIGNIASVSLYAAPITTFKRVIRKKSTEEFSCIPYIIGLLNCLLFTWYGLPVVSKKWENFPLVTVNGVGIVLELSYVIIYFCYASTKGKAKVAMVAIPVLVVFCITAIVSAFAFHDNAHRKQLVGSIGLVVSVTMYASPLIVMKKVIQTKSVEFMPLPLSLCTFLATTLWLTYGVLIRDIFVAGPSVIGIPLSILQLVLHCKYRKRSVVEEPNKENLEKSNLEKVELEKLNLEMEDVEKNVTIHKNGNL*
• ORF Type: complete

Annotations of Ll_transcript_438845

• Blastp: Bidirectional sugar transporter SWEET3 from Arabidopsis with 53.08% of identity
• Blastx: Bidirectional sugar transporter SWEET3 from Arabidopsis with 57.87% of identity
• Eggnog: sugar transporter(ENOG4111M4R)
• Kegg: Link to kegg annotations (AT5G53190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416107.1)
• Pfam: Sugar efflux transporter for intercellular exchange (PF03083.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;