Transcript | Ll_transcript_438851 |
---|---|
CDS coordinates | 832-1302 (+) |
Peptide sequence | MVAIPVLVVFCITAIVSAFAFHDNAHRKQLVGSIGLVVSVTMYASPLIVMKKVIQTKSVEFMPLPLSLCTFLATTLWLTYGVLIRDIFVAGPSVIGIPLSILQLVLHCKYRKRSVVEEPNKENLEKSNLEKVELEKLNLEMEDVEKNVTIHKNGNL* |
ORF Type | complete |
Blastp | Bidirectional sugar transporter SWEET3 from Arabidopsis with 47.4% of identity |
---|---|
Blastx | Bidirectional sugar transporter SWEET3 from Arabidopsis with 57% of identity |
Eggnog | sugar transporter(ENOG4111M4R) |
Kegg | Link to kegg annotations (AT5G53190) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416107.1) |
Pfam | Sugar efflux transporter for intercellular exchange (PF03083.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer