Protein coding transcript 54025

• Transcript: Ll_transcript_438843
• CDS coordinates: 871-1320 (+)
• Peptide sequence: MIAIPILLVFCIIATVSIFAFHNNEHRKLLVGSIGLFVSVVMYGSPLVVMKKVIQTKSVEFMPLPLSLCAFLACSLWLTYGVLIHDIFVGGPSVIGIPLSILQLALHCKYRKRGVVKESNKGDLEKGNLEKVELCELGNGGCGKECDNS*
• ORF Type: complete

Annotations of Ll_transcript_438843

• Blastp: Bidirectional sugar transporter SWEET3 from Arabidopsis with 42.21% of identity
• Blastx: Bidirectional sugar transporter SWEET3 from Arabidopsis with 62.38% of identity
• Eggnog: sugar transporter(ENOG4111M4R)
• Kegg: Link to kegg annotations (AT5G53190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415370.1)
• Pfam: Sugar efflux transporter for intercellular exchange (PF03083.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;