Protein coding transcript 54131

• Transcript: Ll_transcript_438720
• CDS coordinates: 3-491 (+)
• Peptide sequence: FSLYPNEFVFHSSEVVSLWAALGFLPSPKKDETLIDVANQCLHELMSRSFLEEFVNFGTSYYFQIHDLVIDLARSIAEEECYMVSSNTQNVPKNVQHLSFGEPLLGVTTKSVAVRTILFPIEGVGASNEAFLNMCVSRCRYLRILDLSDSTYETLPWSTSKLR
• ORF Type: internal

Annotations of Ll_transcript_438720

• Blastp: Putative disease resistance protein At3g14460 from Arabidopsis with 29.55% of identity
• Blastx: Putative disease resistance protein At3g14460 from Arabidopsis with 29.55% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G14460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425580.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;