Transcript | Ll_transcript_438722 |
---|---|
CDS coordinates | 3-398 (+) |
Peptide sequence | GTSYYFQVHDLKNDLARSIAKEECLMVSSIIQNIPGNVQHLSFAEDDLLAKSFIPKSVVVRTILFPIEGVGASNEAFLNMCVSRYRHLRILDLSDSTYETLPLSIGQMKHLRFLSLERNGKIKRVPDSICKL |
ORF Type | internal |
Blastp | Putative disease resistance protein At3g14460 from Arabidopsis with 33.57% of identity |
---|---|
Blastx | Putative disease resistance protein At3g14460 from Arabidopsis with 33.57% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT3G14460) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425580.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer