Protein coding transcript 54135

• Transcript: Ll_transcript_438714
• CDS coordinates: 1-324 (+)
• Peptide sequence: HEWEFMRDVELRDLAVDNSILLAIPLSYLRMPSHLKQCFELFSLYLNNFVFHISEVASLWAALDLLPSPNKHETLIDVANRCLLELMSRSFFSEHFQLWHFILFSNT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_438714

• Blastp: Putative disease resistance protein At3g14460 from Arabidopsis with 42.67% of identity
• Blastx: Putative disease resistance protein At3g14460 from Arabidopsis with 42.67% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G14460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426156.1)
• Pfam: NB-ARC domain (PF00931.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;