Transcript | Ll_transcript_438717 |
---|---|
CDS coordinates | 2-805 (+) |
Peptide sequence | LQNEKFLLVLDNVWNDDPLKWSELRNLISSGMEGSKILLTTRSHSTAFMMGTIPSHTLKGLSMKDSLSLFQKFAFKEGQEKKFPDLIKVGKEIVNKCGGVPLAITSMGSMLHSKYDIDEWKFMRDSEYWDLPRPNPILHALRLSYLHMPSHLKQCFELFSLYPDDFVFHSSEVASLWAALDLLPSPNKDETLIDVANQCLIELMSRSFLHEFVNFGTSYYFRMHNLVNDLARSIAKDDCHMASINIQEVHENVQHLSFVENDLLSNFF |
ORF Type | internal |
Blastp | Putative disease resistance protein RGA4 from Solanum with 42.25% of identity |
---|---|
Blastx | Putative disease resistance protein RGA4 from Solanum with 42.25% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425580.1) |
Pfam | NB-ARC domain (PF00931.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer