Protein coding transcript 54175

• Transcript: Ll_transcript_439803
• CDS coordinates: 530-901 (+)
• Peptide sequence: MQSNVDALIDMKLEKHKNLREESSFFWREINNGTLRFDRKDFEVEALRQLSHQELIDFFDEYVKVGAPQKRTLSVGVYGKLHSSEYKAEASQPHLTEIDNIFSFRRSQSLYPSFKGLSGHVKL*
• ORF Type: complete

Annotations of Ll_transcript_439803

• Blastp: Insulin-degrading enzyme-like 1, peroxisomal from Arabidopsis with 60% of identity
• Blastx: Insulin-degrading enzyme-like 1, peroxisomal from Arabidopsis with 44.78% of identity
• Eggnog: metalloendopeptidase activity(COG1025)
• Kegg: Link to kegg annotations (AT2G41790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434155.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;