Protein coding transcript 54231

• Transcript: Ll_transcript_440633
• CDS coordinates: 256-720 (+)
• Peptide sequence: MKVLLGGPGTKSGLLLRLGQCAFGAASIALMVTSFGFSGYTAFCYLIASMGLQVLWSFGLACLDIYALRRKRDLQNPILVSLFVVGDWVTATLSLAAACSSAGIVVLYASDLNFCSIHKSLPCNRYKVSVAMAFITWIFTAMSSHVMIWILASV*
• ORF Type: complete

Annotations of Ll_transcript_440633

• Blastp: CASP-like protein 5B2 from Arabidopsis with 72.73% of identity
• Blastx: CASP-like protein 5B2 from Arabidopsis with 72.73% of identity
• Eggnog: CASP-like protein(ENOG410YH2M)
• Kegg: Link to kegg annotations (AT3G53850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420291.1)
• Pfam: Domain of unknown function (DUF588) (PF04535.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;