Protein coding transcript 54243

• Transcript: Ll_transcript_440520
• CDS coordinates: 132-638 (+)
• Peptide sequence: MSSASYPPPPPFYRLYKNYSQDPNSAPSPPPPIEGSYICFGATHTTDNVLPSLEEQGVRQLYPKGPNVDYKKELRSLVGELLLHLLELADILIQRPSQFARRVEEISTVFKNMHHLLNSMRPHQARATLIHIMELQIQRRKEAVEDIKRRRGESQKLLNESLAALDGN*
• ORF Type: complete

Annotations of Ll_transcript_440520

• Blastp: Mediator of RNA polymerase II transcription subunit 7b from Arabidopsis with 71.26% of identity
• Blastx: Mediator of RNA polymerase II transcription subunit 7b from Arabidopsis with 71.26% of identity
• Eggnog: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors(ENOG410ZFRU)
• Kegg: Link to kegg annotations (AT5G03500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459141.1)
• Pfam: MED7 protein (PF05983.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;