Transcript | Ll_transcript_440523 |
---|---|
CDS coordinates | 249-755 (+) |
Peptide sequence | MSSASYPPPPPFYRLYKNYSQDPNSAPSPPPPIEGSYICFGATHTTDNVLPSLEEQGVRQLYPKGPNVDYKKELRSLVGELLLHLLELADILIQRPSQFARRVEEISTVFKNMHHLLNSMRPHQARATLIHIMELQIQRRKEAVEDIKRRRGESQKLLNESLAALDGN* |
ORF Type | complete |
Blastp | Mediator of RNA polymerase II transcription subunit 7b from Arabidopsis with 71.26% of identity |
---|---|
Blastx | Mediator of RNA polymerase II transcription subunit 7b from Arabidopsis with 71.26% of identity |
Eggnog | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors(ENOG410ZFRU) |
Kegg | Link to kegg annotations (AT5G03500) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459141.1) |
Pfam | MED7 protein (PF05983.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer