| Transcript | Ll_transcript_440720 |
|---|---|
| CDS coordinates | 3-383 (+) |
| Peptide sequence | PSCPLIKLQLIVQVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQCQVETLSVPYMKSSQNHNNRLMQRGSAIGDTNEEPKEDLRSRGLCLVPLSCMSFIASDGGTEVWQQTNFGGAT* |
| ORF Type | 5prime_partial |
| Blastp | Transcription factor bHLH110 from Arabidopsis with 68.87% of identity |
|---|---|
| Blastx | Transcription factor bHLH110 from Arabidopsis with 68.87% of identity |
| Eggnog | HLH(ENOG410YI9B) |
| Kegg | Link to kegg annotations (AT1G27660) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019414466.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer