Transcript | Ll_transcript_440711 |
---|---|
CDS coordinates | 166-588 (+) |
Peptide sequence | MQSKGSQSQTASKKSRLESRPSCSPIKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQCQVETLSVPYMKSSQNHNNRLMQRGSAIGDTNEEPKEDLRSRGLCLVPLSCMSFIASDGGTEVWQQTNFGGAT* |
ORF Type | complete |
Blastp | Transcription factor bHLH110 from Arabidopsis with 71.68% of identity |
---|---|
Blastx | Transcription factor bHLH110 from Arabidopsis with 67.44% of identity |
Eggnog | HLH(ENOG410YI9B) |
Kegg | Link to kegg annotations (AT1G27660) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414466.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer