Transcript | Ll_transcript_439272 |
---|---|
CDS coordinates | 151-1062 (+) |
Peptide sequence | MSVVGLDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNPKNSISQIKRLIGKQFSDPELQRDLKSLPFHVTEGPDGYPLIHARYLGEAKSFTPIQVFGMMLSNLKEIAEKNLNAAVVDCCIGIPVYFTDLDRRAVLDAATIAGLRPLHLIHETTATALAYGIYKTDLHETDQLNVAFVDIGHASMQVCIAGFKKGQLKILAHSYDRSLGGRDFDEVLFLYFAAKFKDEYKIDVLQNARASLRLRAACEKLKKVLSANPEAPLNIECLMDEKDVRSFIKRDDFE |
ORF Type | 3prime_partial |
Blastp | Heat shock 70 kDa protein 15 from Arabidopsis with 88.82% of identity |
---|---|
Blastx | Heat shock 70 kDa protein 15 from Arabidopsis with 88.82% of identity |
Eggnog | Heat shock protein(COG0443) |
Kegg | Link to kegg annotations (AT1G79920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455359.1) |
Pfam | Hsp70 protein (PF00012.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer