Protein coding transcript 544

• Transcript: Ll_transcript_524290
• CDS coordinates: 2-316 (+)
• Peptide sequence: SGENFKILYALADKLNAAVGASRAAVDAGFVSNDLQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVAINKDPDAPIFQVSDFGLVQDLFKAVPELTEKL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_524290

• Blastp: Electron transfer flavoprotein subunit alpha, mitochondrial from Bos with 87.5% of identity
• Blastx: Electron transfer flavoprotein subunit alpha, mitochondrial from Bos with 87.5% of identity
• Eggnog: Electron transfer flavoprotein(COG2025)
• Kegg: Link to kegg annotations (521892)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017431454.1)
• Pfam: Electron transfer flavoprotein FAD-binding domain (PF00766.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;