Protein coding transcript 54419

• Transcript: Ll_transcript_438374
• CDS coordinates: 157-813 (+)
• Peptide sequence: MPPSTNSERVQESEKKSSSTVYLNVYDLTPANNYLYLFGVGIFHSGIEVHGMEYGFGAHEYSTSGVFEVEPRSCPGFIFRRSVLLGTTDMSHSEFRSFMERLSSKYHGDTYHLIAKNCNHFTDEVCQQLTGKPIPAWVNRLARVGSFCNCLLPENLQVSAVRHLPERVAYSDDEGSESDASASDDSEEERSTHHFLTPTNGDVAFIHEKPVTLARDLL*
• ORF Type: complete

Annotations of Ll_transcript_438374

• Blastp: DeSI-like protein At4g17486 from Arabidopsis with 66.51% of identity
• Blastx: DeSI-like protein At4g17486 from Arabidopsis with 66.03% of identity
• Eggnog: Desumoylating isopeptidase(ENOG4111H3Z)
• Kegg: Link to kegg annotations (AT4G17486)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421692.1)
• Pfam: PPPDE putative peptidase domain (PF05903.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;