Protein coding transcript 54433

• Transcript: Ll_transcript_438548
• CDS coordinates: 148-576 (+)
• Peptide sequence: MLFSRLSRNVRSNFNRCRWFLSLDDQNHRFLLSHNYHSPRNSIEQVMASSIFSKGLPTLHSSRYHIHHQSSSVVEDELDPFSLVADELSLVSNKLRAMVVAEVPKLASAAEYFFKMGVEGKRFRPTVSIFPSICRHILLFYC*
• ORF Type: complete

Annotations of Ll_transcript_438548

• Blastp: Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial from Arabidopsis with 51.15% of identity
• Blastx: Solanesyl-diphosphate synthase 1, mitochondrial from Oryza sativa with 82.5% of identity
• Eggnog: synthase(COG0142)
• Kegg: Link to kegg annotations (AT2G34630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013457481.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;