Protein coding transcript 54597

• Transcript: Ll_transcript_439754
• CDS coordinates: 2-526 (+)
• Peptide sequence: SLTLSYIFRMWHRGEEEKEYPPPLASHEDLVKDPNVFWDTLRRFHFLMATKFMIPVIGGKELDLHVLYVEVTRRCGYQKVVGEKKWREVGNVFNFSATTTSASFVLRKHYLTLLYHYEQVHFFKLQGPMFTPSPPDAASARTHSWRPELAIVKYSPNPIKDRPDSHAQGKLENS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_439754

• Blastp: High mobility group B protein 9 from Arabidopsis with 69.93% of identity
• Blastx: High mobility group B protein 9 from Arabidopsis with 54.03% of identity
• Eggnog: At rich interactive domain(ENOG410Y2AP)
• Kegg: Link to kegg annotations (AT1G76110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416659.1)
• Pfam: ARID/BRIGHT DNA binding domain (PF01388.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;