Transcript | Ll_transcript_439767 |
---|---|
CDS coordinates | 94-690 (+) |
Peptide sequence | MLGLAKRVGARFLLTSTSEVYGDPLQHPQAETYWGHVNPIGVRSCYDEGKRTAETLAMDYHRGAGIEVRIARIFNTYGPRMCIDDGRVVSNFVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQFPSVNFILEIAKHAFRFSKLSKRASKRWKLLLLDLQPEESARPRSLA* |
ORF Type | complete |
Blastp | UDP-glucuronic acid decarboxylase 4 from Arabidopsis with 94.51% of identity |
---|---|
Blastx | UDP-glucuronic acid decarboxylase 4 from Arabidopsis with 94.51% of identity |
Eggnog | Nad-dependent epimerase dehydratase(COG0451) |
Kegg | Link to kegg annotations (AT2G47650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418262.1) |
Pfam | GDP-mannose 4,6 dehydratase (PF16363.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer