Protein coding transcript 54613

• Transcript: Ll_transcript_439766
• CDS coordinates: 584-979 (+)
• Peptide sequence: MPHFIGHFRFTFSGADFSDTLMDRMVLNEANLTNAILVRTVLTRSDLGGAIIEGADFSDAVLDLTQKQALCKYANGTNPVTGVSTRTSLGCGNKRRNAYGSPSSPLLSAPPQKLLDRDGFCDEATGLCEAK*
• ORF Type: complete

Annotations of Ll_transcript_439766

• Blastp: Thylakoid lumenal protein TL20.3, chloroplastic from Arabidopsis with 83.87% of identity
• Blastx: Thylakoid lumenal protein TL20.3, chloroplastic from Arabidopsis with 83.87% of identity
• Eggnog: pathogenesis(COG1357)
• Kegg: Link to kegg annotations (AT1G12250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020218225.1)
• Pfam: Pentapeptide repeats (8 copies) (PF00805.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;