Transcript | Ll_transcript_439842 |
---|---|
CDS coordinates | 65-550 (+) |
Peptide sequence | MAVNSTSMLYLLSCFSSFIIFMLSFSHVQSHTLKYCDKNANYVVKVSGVEILPNPVVRGEPFTFKIAAFTGEPIQSGDLIYEISYAGFEAPPATFLHDLCEESSCPVPVGHFLLTHTELLPTYTPPGTYNVKLTFKNQNDKQLSCIIFPFKIGAGSSVSAI* |
ORF Type | complete |
Blastp | Putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 from Dictyostelium with 32.09% of identity |
---|---|
Blastx | Putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 from Dictyostelium with 31.45% of identity |
Eggnog | phosphatidylglycerol phosphatidylinositol transfer protein(ENOG4111SSC) |
Kegg | Link to kegg annotations (DDB_G0282179) |
CantataDB | Link to cantataDB annotations (CNT0002594) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461778.1) |
Pfam | ML domain (PF02221.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer