Transcript | Ll_transcript_440035 |
---|---|
CDS coordinates | 3-398 (+) |
Peptide sequence | RCSKEAYPDSKYCERHMHRGKNRSRKPVELLKTPTNTSTNNNSALTSSSVSSNAHHHPYSLYNHQTSSSSSIGLSFEDNSSNATVFLGTGSCSQTNADSRFFLKTKLVHSAQLRINLDMFDVEYTFYYGIV* |
ORF Type | 5prime_partial |
Blastp | Growth-regulating factor 1 from Oryza sativa with 50.91% of identity |
---|---|
Blastx | Growth-regulating factor 1 from Oryza sativa with 93.33% of identity |
Eggnog | growth-regulating factor(ENOG410YGVC) |
Kegg | Link to kegg annotations (4330903) |
CantataDB | - |
Mirbase | osa-MIR396h (MI0013048) |
Ncbi protein | Link to NCBI protein (XP_019417158.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer