Transcript | Ll_transcript_439656 |
---|---|
CDS coordinates | 3-383 (+) |
Peptide sequence | FVSHSNLSQIFSLPLLTSLPTMALTKSIRHPQKALIKKILKRCSSLGKKQQDYDDQGIHLDVPKGHFVVYVGENRSRHIVPISFLSHPQFQNLLHQAEEEFGFDHEMGLTIPCQEHVFESLTSMLK* |
ORF Type | 5prime_partial |
Blastp | Auxin-responsive protein SAUR50 from Arabidopsis with 67.31% of identity |
---|---|
Blastx | Auxin-responsive protein SAUR50 from Arabidopsis with 67.31% of identity |
Eggnog | auxin-induced protein(ENOG410Z28U) |
Kegg | Link to kegg annotations (AT4G34760) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431410.1) |
Pfam | Auxin responsive protein (PF02519.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer