Protein coding transcript 54858

• Transcript: Ll_transcript_439888
• CDS coordinates: 124-501 (+)
• Peptide sequence: MSPGPVVETTTEVATDQQLSSVDDVTAQKKKPQPQEDDAPVVEDVKDDDKDDADEDDEDDDDEDDDGAQGSGEGSKQSRSEKKSRKAMLKLGLKPVTGVSRVTIKRTKNVLFFISKPDVFKSPHSE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_439888

• Blastp: Nascent polypeptide-associated complex subunit alpha-like protein 2 from Arabidopsis with 76.92% of identity
• Blastx: Nascent polypeptide-associated complex subunit alpha-like protein 2 from Arabidopsis with 97.5% of identity
• Eggnog: nascent polypeptide-associated complex(COG1308)
• Kegg: Link to kegg annotations (AT3G49470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417275.1)
• Pfam: NAC domain (PF01849.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;