Protein coding transcript 54862

• Transcript: Ll_transcript_439890
• CDS coordinates: 328-861 (+)
• Peptide sequence: MIDDDDPVLEKAIGTEIEWYPGKCLTQKILKKKPKKGSKNAKPITKIEKCESFFNFFTPPQVPEDDDDDDDDIDDDAVEELQNLMEQDYDIGSTIRDKIIPHAVSWFTGEAAQSDLDEIEADDDDEDDADEDDDDEDGEDDDDDNEEEEGKSQKKGGGKAQHGKGQPTERPAECKQQ*
• ORF Type: complete

Annotations of Ll_transcript_439890

• Blastp: Nucleosome assembly protein 1;2 from Oryza sativa with 69.1% of identity
• Blastx: Nucleosome assembly protein 1;3 from Nicotiana with 87.04% of identity
• Eggnog: nucleosome assembly(ENOG410XQN9)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458367.1)
• Pfam: Nucleosome assembly protein (NAP) (PF00956.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;