Transcript | Ll_transcript_439890 |
---|---|
CDS coordinates | 328-861 (+) |
Peptide sequence | MIDDDDPVLEKAIGTEIEWYPGKCLTQKILKKKPKKGSKNAKPITKIEKCESFFNFFTPPQVPEDDDDDDDDIDDDAVEELQNLMEQDYDIGSTIRDKIIPHAVSWFTGEAAQSDLDEIEADDDDEDDADEDDDDEDGEDDDDDNEEEEGKSQKKGGGKAQHGKGQPTERPAECKQQ* |
ORF Type | complete |
Blastp | Nucleosome assembly protein 1;2 from Oryza sativa with 69.1% of identity |
---|---|
Blastx | Nucleosome assembly protein 1;3 from Nicotiana with 87.04% of identity |
Eggnog | nucleosome assembly(ENOG410XQN9) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458367.1) |
Pfam | Nucleosome assembly protein (NAP) (PF00956.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer