Protein coding transcript 54876

• Transcript: Ll_transcript_438730
• CDS coordinates: 1-627 (+)
• Peptide sequence: PVIAEINHAIGAEGVLSVECKDVVSQYGELIWDLLVSGVKPADVCSQAGLCAFKKDLSESAGIEMVTEKETESKTRGDTPLCSSCQMLVIWIQNQLRQKNTKERVFSYVNQLCESLPSPAGESVISCDSLSRMPNITFTIGDKPFVLTPDQYILRTGEGIAEVCLSGFIALDVPAPRGPLWILGDVFMRVYHTVFDYENAQVGFAIAA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_438730

• Blastp: Aspartic proteinase from Oryza sativa with 56.04% of identity
• Blastx: Aspartic proteinase from Oryza sativa with 56.04% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419261.1)
• Pfam: Eukaryotic aspartyl protease (PF00026.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;