| Transcript | Ll_transcript_438741 |
|---|---|
| CDS coordinates | 3-329 (+) |
| Peptide sequence | RKGYWQIEMGDFLIGGLSTGVCEGGCAVIVDSGTSLLAGPTPVIAEINHAIGAEGVLSVECKDVVSQYGELIWDLLVSGVSFLSFYKKQCFKNREINLARPPGHGSTA* |
| ORF Type | 5prime_partial |
| Blastp | Aspartic proteinase from Oryza sativa with 69.23% of identity |
|---|---|
| Blastx | Aspartic proteinase from Oryza sativa with 55.56% of identity |
| Eggnog | aspartic(ENOG410XNV7) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019419261.1) |
| Pfam | Eukaryotic aspartyl protease (PF00026.22) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer