Transcript | Ll_transcript_438734 |
---|---|
CDS coordinates | 3-329 (+) |
Peptide sequence | RKGYWQIEMGDFLIGGLSTGVCEGGCAVIVDSGTSLLAGPTPVIAEINHAIGAEGVLSVECKDVVSQYGELIWDLLVSGVSFLSFYKKQCFKNREINLARPPGHGSTD* |
ORF Type | 5prime_partial |
Blastp | Aspartic proteinase from Oryza sativa with 69.23% of identity |
---|---|
Blastx | Aspartic proteinase oryzasin-1 from Oryza sativa with 55.81% of identity |
Eggnog | aspartic(ENOG410XNV7) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440635.1) |
Pfam | Eukaryotic aspartyl protease (PF00026.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer