Protein coding transcript 54883

• Transcript: Ll_transcript_438736
• CDS coordinates: 317-664 (+)
• Peptide sequence: MVTEKETESKTRGDTPLCSSCQMLVIWIQNQLRQKNTKERVFSYVNQLCESLPSPAGESVISCDSLSRMPNITFTIGDKPFVLTPDQVSSISPFDKLNFIVDAKDDYFPRNVLQV*
• ORF Type: complete

Annotations of Ll_transcript_438736

• Blastp: Aspartic proteinase from Oryza sativa with 52.38% of identity
• Blastx: Aspartic proteinase from Oryza sativa with 54.35% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419261.1)
• Pfam: Saposin-like type B, region 1 (PF05184.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;