Protein coding transcript 550

• Transcript: Ll_transcript_524294
• CDS coordinates: 221-1561 (+)
• Peptide sequence: MLEGPSFLIARDLPSSCEQETEWIYNCLRVMELSNKRRLELEERAVLRKSRRLSNLPNGGAEGEPQMTALDLSLSLNFNQGNDQNNASDQSELDGLIPQLGRDISINCLLRCSRSDYGLIALLNRSFRSLIRSGEIYRLRRQMGRIEHWVYFSCNIPEWEGYDPNRGRWMHLPRMPSNECFICSDKESLGVGTELLVFGKEIMAPVINRYNILTNTWSSGMKMNVSRCLFGSASLGEIAILAGGSDLCGNVLSSAELYNSETGTWELLPNMNKPRKMSSGVFIDGKFYVVGGIGEDNVRQLTCGEEFDLETRKWREIPNMFPRRTGERGVDEIPSMIEAPPLIAVVNNVLYAADYAHQEVRRYYKDSNSWVTVGRLPERVSSMNGWGLAFRACGDRLVVVGGPRAIMDRGLIEVNACFPGDGALQWNRLASKQCGNFVYNCAVMGC*
• ORF Type: complete

Annotations of Ll_transcript_524294

• Blastp: F-box/kelch-repeat protein At1g74510 from Arabidopsis with 57.17% of identity
• Blastx: F-box/kelch-repeat protein At1g74510 from Arabidopsis with 56.51% of identity
• Eggnog: Kelch repeat-containing F-box family protein(ENOG4110X8D)
• Kegg: Link to kegg annotations (AT1G74510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429477.1)
• Pfam: Kelch motif (PF01344.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;