Protein coding transcript 55043

• Transcript: Ll_transcript_439240
• CDS coordinates: 174-794 (+)
• Peptide sequence: MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSLKSFENLNNWREEFLIQASPSDPENFPFVVIGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGVNVEEAFQCIAKNALKSGEEEELYLPDTIDVGSSSQQRSTGCEC*
• ORF Type: complete

Annotations of Ll_transcript_439240

• Blastp: Ras-related protein RABG3f from Arabidopsis with 95.15% of identity
• Blastx: Ras-related protein RABG3f from Arabidopsis with 95.15% of identity
• Eggnog: member RAS oncogene family(ENOG410XNZV)
• Kegg: Link to kegg annotations (AT3G18820)
• CantataDB: Link to cantataDB annotations (CNT0000393)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412820.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;