Protein coding transcript 55044

• Transcript: Ll_transcript_439239
• CDS coordinates: 161-568 (+)
• Peptide sequence: MATTACFIIVSRNDIPIYEAEVGVAAKREDAAQLHQFILHAALDVVQDLAWTTSAMYLKSVDRFNELVVSVYVTAGHTRLMLLHDSRNDDGIKSFFQEVHELYIKTLLNPLYLPGSRITSSHFDTKVRALARKYL*
• ORF Type: complete

Annotations of Ll_transcript_439239

• Blastp: Trafficking protein particle complex subunit 2 from Sus with 50% of identity
• Blastx: Transport protein particle 20 kDa subunit from Schizosaccharomyces with 48.06% of identity
• Eggnog: trafficking protein particle complex(COG5603)
• Kegg: Link to kegg annotations (100513447)
• CantataDB: Link to cantataDB annotations (CNT0002066)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429739.1)
• Pfam: Sedlin, N-terminal conserved region (PF04628.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;