Protein coding transcript 55066

• Transcript: Ll_transcript_441009
• CDS coordinates: 141-656 (+)
• Peptide sequence: MSQMNSCIFEWQRLYQMDARRFVVANVGPIGCIPYQKTINQLKEGQCVDLAENLAIQYNSRLKDLLAELNDNLHGSTFVLANVYDLVRELITNYGKYGFRTASVACCGDGGQYAGIIPCGSTSSLCTDRYKHVFWDPYHPSEAANILLAKNLVDGDNRYVSPINLRQLRDL*
• ORF Type: complete

Annotations of Ll_transcript_441009

• Blastp: GDSL esterase/lipase At2g23540 from Arabidopsis with 70.37% of identity
• Blastx: GDSL esterase/lipase At2g23540 from Arabidopsis with 70.37% of identity
• Eggnog: GDSL esterase lipase(ENOG410ZH2N)
• Kegg: Link to kegg annotations (AT2G23540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420507.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;