Transcript | Ll_transcript_438472 |
---|---|
CDS coordinates | 2-433 (+) |
Peptide sequence | LSMEDNQTNSSSEDVKDNSKEGLKCAPEKTASNVCCSCSKSSSCKTTKCQCRALGNNCGSSCGCLATKCANRASVSNESQELTQSGVEGTGNDSRIVETDKNQILATQGAELLQGALVDRTAETNKAHRPRRPLSDIGNTAVR* |
ORF Type | 5prime_partial |
Blastp | Kinesin-like protein KIN-4C from Arabidopsis with 46.53% of identity |
---|---|
Blastx | Kinesin-like protein KIN-4C from Arabidopsis with 45.45% of identity |
Eggnog | Kinesin family member(COG5059) |
Kegg | Link to kegg annotations (AT5G60930) |
CantataDB | Link to cantataDB annotations (CNT0002543) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456477.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer