| Transcript | Ll_transcript_440222 |
|---|---|
| CDS coordinates | 1316-1624 (+) |
| Peptide sequence | MGCLLGCDPGLSCELVKKYISPASTCPGHYVGVIQDEPSSTPYSGYINDVPRFIWNFLADRTSISREHNGSSNCQNGCNGRDEVCIKAEIDGKGACVLSTTRY |
| ORF Type | 3prime_partial |
| Blastp | Nicastrin from Arabidopsis with 62.5% of identity |
|---|---|
| Blastx | Nicastrin from Arabidopsis with 66.48% of identity |
| Eggnog | nicastrin(ENOG410XT6X) |
| Kegg | Link to kegg annotations (AT3G52640) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019419602.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer